SCOP 1.67: Domain d1osvb_: 1osv B:

Lineage for d1osvb_ (1osv B:)

1. Root: SCOP 1.67

2. Class a: All alpha proteins [46456] (202 folds)

3. Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
   multihelical; 3 layers or orthogonally packed helices

4. Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (1 family)

5. Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (27 proteins)

6. Protein Bile acid receptor FXR [101433] (2 species)

7. Species Rat (Rattus norvegicus) [TaxId:10116] [101435] (2 PDB entries)

8. Domain d1osvb_: 1osv B: [93501]
   complexed with a co-activator peptide, chains C, D and E
   complexed with chc

Details for d1osvb_

PDB Entry: 1osv, 2.5 Å

PDB Description: structural basis for bile acid binding and activation of the nuclear receptor fxr

SCOP Domain Sequences for d1osvb_:

Sequence; same for both SEQRES and ATOM records:

>d1osvb_ a.123.1.1 (B:) Bile acid receptor FXR {Rat (Rattus norvegicus)}
aeltvdqqtlldyimdsyskqrmpqeitnkilkeefsaeenfliltematshvqilveft
krlpgfqtldhedqiallkgsaveamflrsaeifnkklpaghadlleerirksgisdeyi
tpmfsfyksvgelkmtqeeyalltaivilspdrqyikdreaveklqeplldvlqklckiy
qpenpqhfacllgrltelrtfnhhhaemlmswrvndhkftpllceiwdv

Timeline for d1osvb_:

• d1osvb_ is new in SCOP 1.67
  
• d1osvb_ appears in SCOP 1.69
  
• d1osvb_ appears in the current release, SCOPe 2.08, called d1osvb1