Lineage for d1osvb_ (1osv B:)

  1. Root: SCOP 1.67
  2. 349259Class a: All alpha proteins [46456] (202 folds)
  3. 360318Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 360319Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (1 family) (S)
  5. 360320Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (27 protein domains)
  6. 360328Protein Bile acid receptor FXR [101433] (2 species)
  7. 360331Species Rat (Rattus norvegicus) [TaxId:10116] [101435] (2 PDB entries)
  8. 360333Domain d1osvb_: 1osv B: [93501]
    complexed with a co-activator peptide, chains C, D and E
    complexed with chc

Details for d1osvb_

PDB Entry: 1osv (more details), 2.5 Å

PDB Description: structural basis for bile acid binding and activation of the nuclear receptor fxr

SCOP Domain Sequences for d1osvb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1osvb_ a.123.1.1 (B:) Bile acid receptor FXR {Rat (Rattus norvegicus)}
aeltvdqqtlldyimdsyskqrmpqeitnkilkeefsaeenfliltematshvqilveft
krlpgfqtldhedqiallkgsaveamflrsaeifnkklpaghadlleerirksgisdeyi
tpmfsfyksvgelkmtqeeyalltaivilspdrqyikdreaveklqeplldvlqklckiy
qpenpqhfacllgrltelrtfnhhhaemlmswrvndhkftpllceiwdv

SCOP Domain Coordinates for d1osvb_:

Click to download the PDB-style file with coordinates for d1osvb_.
(The format of our PDB-style files is described here.)

Timeline for d1osvb_: