Lineage for d1osva_ (1osv A:)
- Root: SCOP 1.67
Class a: All alpha proteins [46456] (202 folds) 
Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
multihelical; 3 layers or orthogonally packed helicesSuperfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (1 family) 
Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (27 proteins) 
Protein Bile acid receptor FXR [101433] (2 species) 
Species Rat (Rattus norvegicus) [TaxId:10116] [101435] (2 PDB entries) 
Domain d1osva_: 1osv A: [93500]
Details for d1osva_
PDB Entry: 1osv (more details), 2.5 Å
PDB Description: structural basis for bile acid binding and activation of the nuclear receptor fxr
SCOP Domain Sequences for d1osva_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1osva_ a.123.1.1 (A:) Bile acid receptor FXR {Rat (Rattus norvegicus)}
aeltvdqqtlldyimdsyskqrmpqeitnkilkeefsaeenfliltematshvqilveft
krlpgfqtldhedqiallkgsaveamflrsaeifnkklpaghadlleerirksgisdeyi
tpmfsfyksvgelkmtqeeyalltaivilspdrqyikdreaveklqeplldvlqklckiy
qpenpqhfacllgrltelrtfnhhhaemlmswrvndhkftpllceiwdv
SCOP Domain Coordinates for d1osva_:
Click to download the PDB-style file with coordinates for d1osva_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1osva_:
- d1osva_ is new in SCOP 1.67
- d1osva_ appears in SCOP 1.69
- d1osva_ appears in the current release, SCOPe 2.08, called d1osva1
View in 3D
