| Class b: All beta proteins [48724] (176 folds) |
| Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) ![]() |
| Family b.47.1.1: Prokaryotic proteases [50495] (16 proteins) |
| Protein Trypsin [50504] (1 species) |
| Species Streptomyces griseus, strain k1 [TaxId:1911] [50505] (7 PDB entries) |
| Domain d1ossa_: 1oss A: [93499] complexed with ben, ca, so4 |
PDB Entry: 1oss (more details), 1.93 Å
SCOPe Domain Sequences for d1ossa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ossa_ b.47.1.1 (A:) Trypsin {Streptomyces griseus, strain k1 [TaxId: 1911]}
vvggtraaqgefpfmvrlsmgcggalyaqdivltaahcvsgsgnntsitatggvvdlqss
savkvrstkvlqapgyngtgkdwaliklaqpinqptlkiatttaynqgtftvagwganre
ggsqqryllkanvpfvsdaacrsaygnelvaneeicagypdtggvdpcqgdsggpmfrkd
nadewiqvgivswgygcarpgypgvytevstfasaiasaartl
Timeline for d1ossa_: