SCOP 1.67: Domain d1oscf_: 1osc F:

Lineage for d1oscf_ (1osc F:)

1. Root: SCOP 1.67

2. Class d: Alpha and beta proteins (a+b) [53931] (260 folds)

3. Fold d.58: Ferredoxin-like [54861] (48 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.5: GlnB-like [54913] (4 families)
   form timeric structures with the orthogonally packed beta-sheets

5. Family d.58.5.2: Divalent ion tolerance proteins CutA (CutA1) [75434] (3 proteins)

6. Protein Mammalian CutA-like protein [102975] (1 species)

7. Species Rat (Rattus norvegicus) [TaxId:10116] [102976] (1 PDB entry)

8. Domain d1oscf_: 1osc F: [93495]

Details for d1oscf_

PDB Entry: 1osc, 2.15 Å

PDB Description: crystal structure of rat cuta1 at 2.15 a resolution

SCOP Domain Sequences for d1oscf_:

Sequence, based on SEQRES records:

>d1oscf_ d.58.5.2 (F:) Mammalian CutA-like protein {Rat (Rattus norvegicus)}
gsgyvpgsvsaafvtcpnekvakeiaravvekrlaacvnlipqitsiyewkgkieedsev
lmmiktqsslvpaltefvrsvhpyevaevialpveqgnppylhwvhqvtesv

Sequence, based on observed residues (ATOM records):

>d1oscf_ d.58.5.2 (F:) Mammalian CutA-like protein {Rat (Rattus norvegicus)}
gsgyvpgsvsaafvtcpnekvakeiaravvekrlaacvnlipqitsiyewkgkieedsev
lmmiktqsslvpaltefvrsvhpyvaevialpveqgnppylhwvhqvtesv

Timeline for d1oscf_:

• d1oscf_ is new in SCOP 1.67
  
• d1oscf_ appears in SCOP 1.69
  
• d1oscf_ appears in the current release, SCOPe 2.08