SCOP 1.69: Domain d1oscc_: 1osc C:

Lineage for d1oscc_ (1osc C:)

1. Root: SCOP 1.69

2. Class d: Alpha and beta proteins (a+b) [53931] (279 folds)

3. Fold d.58: Ferredoxin-like [54861] (49 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.5: GlnB-like [54913] (4 families)
   form timeric structures with the orthogonally packed beta-sheets

5. Family d.58.5.2: Divalent ion tolerance proteins CutA (CutA1) [75434] (3 proteins)

6. Protein Mammalian CutA-like protein [102975] (1 species)

7. Species Rat (Rattus norvegicus) [TaxId:10116] [102976] (1 PDB entry)

8. Domain d1oscc_: 1osc C: [93492]

Details for d1oscc_

PDB Entry: 1osc, 2.15 Å

PDB Description: crystal structure of rat cuta1 at 2.15 a resolution

SCOP Domain Sequences for d1oscc_:

Sequence; same for both SEQRES and ATOM records:

>d1oscc_ d.58.5.2 (C:) Mammalian CutA-like protein {Rat (Rattus norvegicus)}
yvpgsvsaafvtcpnekvakeiaravvekrlaacvnlipqitsiyewkgkieedsevlmm
iktqsslvpaltefvrsvhpyevaevialpveqgnppylhwvhqvtes

Timeline for d1oscc_:

• d1oscc_ first appeared in SCOP 1.67
  
• d1oscc_ appears in SCOP 1.71
  
• d1oscc_ appears in the current release, SCOPe 2.08