Lineage for d1osca_ (1osc A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2950563Superfamily d.58.5: GlnB-like [54913] (6 families) (S)
    form timeric structures with the orthogonally packed beta-sheets
  5. 2950720Family d.58.5.2: Divalent ion tolerance proteins CutA (CutA1) [75434] (4 proteins)
  6. 2950805Protein Mammalian CutA-like protein [102975] (2 species)
  7. 2950819Species Norway rat (Rattus norvegicus) [TaxId:10116] [102976] (1 PDB entry)
  8. 2950820Domain d1osca_: 1osc A: [93490]

Details for d1osca_

PDB Entry: 1osc (more details), 2.15 Å

PDB Description: crystal structure of rat cuta1 at 2.15 a resolution
PDB Compounds: (A:) similar to divalent cation tolerant protein CUTA

SCOPe Domain Sequences for d1osca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1osca_ d.58.5.2 (A:) Mammalian CutA-like protein {Norway rat (Rattus norvegicus) [TaxId: 10116]}
yvpgsvsaafvtcpnekvakeiaravvekrlaacvnlipqitsiyewkgkieedsevlmm
iktqsslvpaltefvrsvhpyevaevialpveqgnppylhwvhqvtes

SCOPe Domain Coordinates for d1osca_:

Click to download the PDB-style file with coordinates for d1osca_.
(The format of our PDB-style files is described here.)

Timeline for d1osca_: