SCOPe 2.05: Domain d1os9e_: 1os9 E:

Lineage for d1os9e_ (1os9 E:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.92: Zincin-like [55485] (2 superfamilies)
   contains mixed beta sheet with connection over free side of the sheet

4. Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families)

5. Family d.92.1.11: Matrix metalloproteases, catalytic domain [55528] (14 proteins)

6. Protein Macrophage elastase (MMP-12) [69780] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [69781] (36 PDB entries)
   Uniprot P39900 106-263 ! Uniprot P39900 106-264

8. Domain d1os9e_: 1os9 E: [93486]
   complexed with ca, zn

Details for d1os9e_

PDB Entry: 1os9, 1.85 Å

PDB Description: binary enzyme-product complexes of human mmp12

PDB Compounds: (E:) Macrophage metalloelastase

SCOPe Domain Sequences for d1os9e_:

Sequence; same for both SEQRES and ATOM records:

>d1os9e_ d.92.1.11 (E:) Macrophage elastase (MMP-12) {Human (Homo sapiens) [TaxId: 9606]}
mmgpvwrkhyityrinnytpdmnredvdyairkafqvwsnvtplkfskintgmadilvvf
argahgddhafdgkggilahafgpgsgiggdahfdedefwtthsggtnlfltavheighs
lglghssdpkavmfptykyvdintfrlsaddirgiqslygdpken

Timeline for d1os9e_:

• d1os9e_ first appeared in SCOP 1.67
  
• d1os9e_ appears in SCOPe 2.04
  
• d1os9e_ is called d1os9e1 in SCOPe 2.06
  
• d1os9e_ appears in the current release, SCOPe 2.08, called d1os9e1