Lineage for d1os9e_ (1os9 E:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1660634Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 1660635Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families) (S)
  5. 1661136Family d.92.1.11: Matrix metalloproteases, catalytic domain [55528] (14 proteins)
  6. 1661282Protein Macrophage elastase (MMP-12) [69780] (1 species)
  7. 1661283Species Human (Homo sapiens) [TaxId:9606] [69781] (36 PDB entries)
    Uniprot P39900 106-263 ! Uniprot P39900 106-264
  8. 1661307Domain d1os9e_: 1os9 E: [93486]
    complexed with ca, zn

Details for d1os9e_

PDB Entry: 1os9 (more details), 1.85 Å

PDB Description: binary enzyme-product complexes of human mmp12
PDB Compounds: (E:) Macrophage metalloelastase

SCOPe Domain Sequences for d1os9e_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1os9e_ d.92.1.11 (E:) Macrophage elastase (MMP-12) {Human (Homo sapiens) [TaxId: 9606]}
mmgpvwrkhyityrinnytpdmnredvdyairkafqvwsnvtplkfskintgmadilvvf
argahgddhafdgkggilahafgpgsgiggdahfdedefwtthsggtnlfltavheighs
lglghssdpkavmfptykyvdintfrlsaddirgiqslygdpken

SCOPe Domain Coordinates for d1os9e_:

Click to download the PDB-style file with coordinates for d1os9e_.
(The format of our PDB-style files is described here.)

Timeline for d1os9e_: