Lineage for d1os9d_ (1os9 D:)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 607530Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 607531Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (15 families) (S)
  5. 607753Family d.92.1.11: Matrix metalloproteases, catalytic domain [55528] (13 proteins)
  6. 607801Protein Macrophage elastase (MMP-12) [69780] (1 species)
  7. 607802Species Human (Homo sapiens) [TaxId:9606] [69781] (8 PDB entries)
  8. 607808Domain d1os9d_: 1os9 D: [93485]

Details for d1os9d_

PDB Entry: 1os9 (more details), 1.85 Å

PDB Description: binary enzyme-product complexes of human mmp12

SCOP Domain Sequences for d1os9d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1os9d_ d.92.1.11 (D:) Macrophage elastase (MMP-12) {Human (Homo sapiens)}
mmgpvwrkhyityrinnytpdmnredvdyairkafqvwsnvtplkfskintgmadilvvf
argahgddhafdgkggilahafgpgsgiggdahfdedefwtthsggtnlfltavheighs
lglghssdpkavmfptykyvdintfrlsaddirgiqslygdpken

SCOP Domain Coordinates for d1os9d_:

Click to download the PDB-style file with coordinates for d1os9d_.
(The format of our PDB-style files is described here.)

Timeline for d1os9d_: