![]() | Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
![]() | Fold d.92: Zincin-like [55485] (2 superfamilies) contains mixed beta sheet with connection over free side of the sheet |
![]() | Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families) ![]() |
![]() | Family d.92.1.11: Matrix metalloproteases, catalytic domain [55528] (14 proteins) |
![]() | Protein Macrophage elastase (MMP-12) [69780] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [69781] (36 PDB entries) Uniprot P39900 106-263 ! Uniprot P39900 106-264 |
![]() | Domain d1os9c_: 1os9 C: [93484] complexed with ca, zn |
PDB Entry: 1os9 (more details), 1.85 Å
SCOPe Domain Sequences for d1os9c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1os9c_ d.92.1.11 (C:) Macrophage elastase (MMP-12) {Human (Homo sapiens) [TaxId: 9606]} mmgpvwrkhyityrinnytpdmnredvdyairkafqvwsnvtplkfskintgmadilvvf argahgddhafdgkggilahafgpgsgiggdahfdedefwtthsggtnlfltavheighs lglghssdpkavmfptykyvdintfrlsaddirgiqslygdpken
Timeline for d1os9c_: