Lineage for d1os9a_ (1os9 A:)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 507855Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 507856Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (15 families) (S)
  5. 508071Family d.92.1.11: Matrix metalloproteases, catalytic domain [55528] (13 proteins)
  6. 508117Protein Macrophage elastase (MMP-12) [69780] (1 species)
  7. 508118Species Human (Homo sapiens) [TaxId:9606] [69781] (4 PDB entries)
  8. 508120Domain d1os9a_: 1os9 A: [93482]

Details for d1os9a_

PDB Entry: 1os9 (more details), 1.85 Å

PDB Description: binary enzyme-product complexes of human mmp12

SCOP Domain Sequences for d1os9a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1os9a_ d.92.1.11 (A:) Macrophage elastase (MMP-12) {Human (Homo sapiens)}
mmgpvwrkhyityrinnytpdmnredvdyairkafqvwsnvtplkfskintgmadilvvf
argahgddhafdgkggilahafgpgsgiggdahfdedefwtthsggtnlfltavheighs
lglghssdpkavmfptykyvdintfrlsaddirgiqslygdpken

SCOP Domain Coordinates for d1os9a_:

Click to download the PDB-style file with coordinates for d1os9a_.
(The format of our PDB-style files is described here.)

Timeline for d1os9a_: