SCOPe 2.08: Domain d1os9a1: 1os9 A:106-268

Lineage for d1os9a1 (1os9 A:106-268)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.92: Zincin-like [55485] (2 superfamilies)
   contains mixed beta sheet with connection over free side of the sheet

4. Superfamily d.92.1: Metalloproteases ('zincins'), catalytic domain [55486] (18 families)

5. Family d.92.1.11: Matrix metalloproteases, catalytic domain [55528] (14 proteins)

6. Protein Macrophage elastase (MMP-12) [69780] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [69781] (58 PDB entries)
   Uniprot P39900 106-263 ! Uniprot P39900 106-264

8. Domain d1os9a1: 1os9 A:106-268 [93482]
   Other proteins in same PDB: d1os9a2, d1os9b2, d1os9c2, d1os9d2, d1os9e2, d1os9f2
   complexed with ca, zn

Details for d1os9a1

PDB Entry: 1os9, 1.85 Å

PDB Description: binary enzyme-product complexes of human mmp12

PDB Compounds: (A:) Macrophage metalloelastase

SCOPe Domain Sequences for d1os9a1:

Sequence; same for both SEQRES and ATOM records:

>d1os9a1 d.92.1.11 (A:106-268) Macrophage elastase (MMP-12) {Human (Homo sapiens) [TaxId: 9606]}
gpvwrkhyityrinnytpdmnredvdyairkafqvwsnvtplkfskintgmadilvvfar
gahgddhafdgkggilahafgpgsgiggdahfdedefwtthsggtnlfltavheighslg
lghssdpkavmfptykyvdintfrlsaddirgiqslygdpken

Timeline for d1os9a1:

• d1os9a1 first appeared in SCOP 1.67, called d1os9a_
  
• d1os9a1 appears in SCOPe 2.07