SCOPe 2.05: Domain d1os7d_: 1os7 D:

Lineage for d1os7d_ (1os7 D:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
   one turn of helix is made by two pairs of antiparallel strands linked with short turns
   has appearance of a sandwich of distinct architecture and jelly-roll topology

4. Superfamily b.82.2: Clavaminate synthase-like [51197] (16 families)
   Iron and ketoglutarate-dependent enzymes; elaborated version of this common fold

5. Family b.82.2.5: TauD/TfdA-like [75038] (3 proteins)
   automatically mapped to Pfam PF02668

6. Protein Taurine/alpha-ketoglutarate dioxygenase TauD [75039] (1 species)

7. Species Escherichia coli [TaxId:562] [75040] (4 PDB entries)

8. Domain d1os7d_: 1os7 D: [93480]
   complexed with akg, fe2, tau

Details for d1os7d_

PDB Entry: 1os7, 2.5 Å

PDB Description: Crystal structure of TauD with iron, alpha-ketoglutarate and Taurine bound at pH 7.5

PDB Compounds: (D:) Alpha-Ketoglutarate-Dependent Taurine Dioxygenase

SCOPe Domain Sequences for d1os7d_:

Sequence; same for both SEQRES and ATOM records:

>d1os7d_ b.82.2.5 (D:) Taurine/alpha-ketoglutarate dioxygenase TauD {Escherichia coli [TaxId: 562]}
erlsitplgpyigaqisgadltrplsdnqfeqlyhavlrhqvvflrdqaitpqqqralaq
rfgelhihpvyphaegvdeiivldthndnppdndnwhtdvtfietppagailaakelpst
ggdtlwtsgiaayealsvpfrqllsglraehdfrksfpeykyrkteeehqrwreavaknp
pllhpvvrthpvsgkqalfvnegfttrivdvsekeseallsflfahitkpefqvrwrwqp
ndiaiwdnrvtqhyanadylpqrrimhratilgdkpfyra

Timeline for d1os7d_:

• d1os7d_ first appeared in SCOP 1.67
  
• d1os7d_ appears in SCOPe 2.04
  
• d1os7d_ appears in SCOPe 2.06
  
• d1os7d_ appears in the current release, SCOPe 2.08