![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies) one turn of helix is made by two pairs of antiparallel strands linked with short turns has appearance of a sandwich of distinct architecture and jelly-roll topology |
![]() | Superfamily b.82.2: Clavaminate synthase-like [51197] (16 families) ![]() Iron and ketoglutarate-dependent enzymes; elaborated version of this common fold |
![]() | Family b.82.2.5: TauD/TfdA-like [75038] (5 proteins) automatically mapped to Pfam PF02668 |
![]() | Protein Taurine/alpha-ketoglutarate dioxygenase TauD [75039] (2 species) |
![]() | Species Escherichia coli [TaxId:562] [75040] (4 PDB entries) |
![]() | Domain d1os7d_: 1os7 D: [93480] complexed with akg, fe2, tau |
PDB Entry: 1os7 (more details), 2.5 Å
SCOPe Domain Sequences for d1os7d_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1os7d_ b.82.2.5 (D:) Taurine/alpha-ketoglutarate dioxygenase TauD {Escherichia coli [TaxId: 562]} erlsitplgpyigaqisgadltrplsdnqfeqlyhavlrhqvvflrdqaitpqqqralaq rfgelhihpvyphaegvdeiivldthndnppdndnwhtdvtfietppagailaakelpst ggdtlwtsgiaayealsvpfrqllsglraehdfrksfpeykyrkteeehqrwreavaknp pllhpvvrthpvsgkqalfvnegfttrivdvsekeseallsflfahitkpefqvrwrwqp ndiaiwdnrvtqhyanadylpqrrimhratilgdkpfyra
Timeline for d1os7d_: