SCOP 1.67: Domain d1os2f_: 1os2 F:

Lineage for d1os2f_ (1os2 F:)

1. Root: SCOP 1.67

2. Class d: Alpha and beta proteins (a+b) [53931] (260 folds)

3. Fold d.92: Zincin-like [55485] (2 superfamilies)
   contains mixed beta sheet with connection over free side of the sheet

4. Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (15 families)

5. Family d.92.1.11: Matrix metalloproteases, catalytic domain [55528] (13 proteins)

6. Protein Macrophage elastase (MMP-12) [69780] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [69781] (4 PDB entries)

8. Domain d1os2f_: 1os2 F: [93474]
   complexed with act, azi, ca, hae, zn; mutant

Details for d1os2f_

PDB Entry: 1os2, 2.15 Å

PDB Description: ternary enzyme-product-inhibitor complexes of human mmp12

SCOP Domain Sequences for d1os2f_:

Sequence; same for both SEQRES and ATOM records:

>d1os2f_ d.92.1.11 (F:) Macrophage elastase (MMP-12) {Human (Homo sapiens)}
mmgpvwrkhyityrinnytpdmnredvdyairkafqvwsnvtplkfskintgmadilvvf
argahgddhafdgkggilahafgpgsgiggdahfdedefwtthsggtnlfltavheighs
lglghssdpkavmfptykyvdintfrlsaddirgiqslygdpken

Timeline for d1os2f_:

• d1os2f_ is new in SCOP 1.67
  
• d1os2f_ appears in SCOP 1.69
  
• d1os2f_ appears in the current release, SCOPe 2.08, called d1os2f1