SCOP 1.73: Domain d1os2c_: 1os2 C:

Lineage for d1os2c_ (1os2 C:)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.92: Zincin-like [55485] (2 superfamilies)
   contains mixed beta sheet with connection over free side of the sheet

4. Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (15 families)

5. Family d.92.1.11: Matrix metalloproteases, catalytic domain [55528] (13 proteins)

6. Protein Macrophage elastase (MMP-12) [69780] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [69781] (15 PDB entries)

8. Domain d1os2c_: 1os2 C: [93471]

Details for d1os2c_

PDB Entry: 1os2, 2.15 Å

PDB Description: ternary enzyme-product-inhibitor complexes of human mmp12

PDB Compounds: (C:) Macrophage metalloelastase

SCOP Domain Sequences for d1os2c_:

Sequence; same for both SEQRES and ATOM records:

>d1os2c_ d.92.1.11 (C:) Macrophage elastase (MMP-12) {Human (Homo sapiens) [TaxId: 9606]}
mmgpvwrkhyityrinnytpdmnredvdyairkafqvwsnvtplkfskintgmadilvvf
argahgddhafdgkggilahafgpgsgiggdahfdedefwtthsggtnlfltavheighs
lglghssdpkavmfptykyvdintfrlsaddirgiqslygdpken

Timeline for d1os2c_:

• d1os2c_ first appeared in SCOP 1.67
  
• d1os2c_ appears in SCOP 1.71
  
• d1os2c_ appears in SCOP 1.75
  
• d1os2c_ appears in the current release, SCOPe 2.08, called d1os2c1