Lineage for d1os2c1 (1os2 C:106-268)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2963580Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 2963581Superfamily d.92.1: Metalloproteases ('zincins'), catalytic domain [55486] (18 families) (S)
  5. 2964231Family d.92.1.11: Matrix metalloproteases, catalytic domain [55528] (14 proteins)
  6. 2964411Protein Macrophage elastase (MMP-12) [69780] (1 species)
  7. 2964412Species Human (Homo sapiens) [TaxId:9606] [69781] (58 PDB entries)
    Uniprot P39900 106-263 ! Uniprot P39900 106-264
  8. 2964466Domain d1os2c1: 1os2 C:106-268 [93471]
    Other proteins in same PDB: d1os2a2, d1os2b2, d1os2c2, d1os2d2, d1os2e2, d1os2f2
    complexed with act, azi, ca, hae, zn

Details for d1os2c1

PDB Entry: 1os2 (more details), 2.15 Å

PDB Description: ternary enzyme-product-inhibitor complexes of human mmp12
PDB Compounds: (C:) Macrophage metalloelastase

SCOPe Domain Sequences for d1os2c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1os2c1 d.92.1.11 (C:106-268) Macrophage elastase (MMP-12) {Human (Homo sapiens) [TaxId: 9606]}
gpvwrkhyityrinnytpdmnredvdyairkafqvwsnvtplkfskintgmadilvvfar
gahgddhafdgkggilahafgpgsgiggdahfdedefwtthsggtnlfltavheighslg
lghssdpkavmfptykyvdintfrlsaddirgiqslygdpken

SCOPe Domain Coordinates for d1os2c1:

Click to download the PDB-style file with coordinates for d1os2c1.
(The format of our PDB-style files is described here.)

Timeline for d1os2c1: