Lineage for d1os2a_ (1os2 A:)
- Root: SCOPe 2.05
Class d: Alpha and beta proteins (a+b) [53931] (381 folds) 
Fold d.92: Zincin-like [55485] (2 superfamilies)
contains mixed beta sheet with connection over free side of the sheetSuperfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families) 
Family d.92.1.11: Matrix metalloproteases, catalytic domain [55528] (14 proteins) Protein Macrophage elastase (MMP-12) [69780] (1 species) Species Human (Homo sapiens) [TaxId:9606] [69781] (36 PDB entries)
Uniprot P39900 106-263 ! Uniprot P39900 106-264
Domain d1os2a_: 1os2 A: [93469]
complexed with act, azi, ca, hae, zn
Details for d1os2a_
PDB Entry: 1os2 (more details), 2.15 Å
PDB Description: ternary enzyme-product-inhibitor complexes of human mmp12
PDB Compounds: (A:) Macrophage metalloelastaseSCOPe Domain Sequences for d1os2a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1os2a_ d.92.1.11 (A:) Macrophage elastase (MMP-12) {Human (Homo sapiens) [TaxId: 9606]}
mmgpvwrkhyityrinnytpdmnredvdyairkafqvwsnvtplkfskintgmadilvvf
argahgddhafdgkggilahafgpgsgiggdahfdedefwtthsggtnlfltavheighs
lglghssdpkavmfptykyvdintfrlsaddirgiqslygdpken
SCOPe Domain Coordinates for d1os2a_:
Click to download the PDB-style file with coordinates for d1os2a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1os2a_:
- d1os2a_ first appeared in SCOP 1.67
- d1os2a_ appears in SCOPe 2.04
- d1os2a_ is called d1os2a1 in SCOPe 2.06
- d1os2a_ appears in the current release, SCOPe 2.08, called d1os2a1
View in 3D
