Lineage for d1os2a_ (1os2 A:)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 607530Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 607531Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (15 families) (S)
  5. 607753Family d.92.1.11: Matrix metalloproteases, catalytic domain [55528] (13 proteins)
  6. 607801Protein Macrophage elastase (MMP-12) [69780] (1 species)
  7. 607802Species Human (Homo sapiens) [TaxId:9606] [69781] (8 PDB entries)
  8. 607814Domain d1os2a_: 1os2 A: [93469]

Details for d1os2a_

PDB Entry: 1os2 (more details), 2.15 Å

PDB Description: ternary enzyme-product-inhibitor complexes of human mmp12

SCOP Domain Sequences for d1os2a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1os2a_ d.92.1.11 (A:) Macrophage elastase (MMP-12) {Human (Homo sapiens)}
mmgpvwrkhyityrinnytpdmnredvdyairkafqvwsnvtplkfskintgmadilvvf
argahgddhafdgkggilahafgpgsgiggdahfdedefwtthsggtnlfltavheighs
lglghssdpkavmfptykyvdintfrlsaddirgiqslygdpken

SCOP Domain Coordinates for d1os2a_:

Click to download the PDB-style file with coordinates for d1os2a_.
(The format of our PDB-style files is described here.)

Timeline for d1os2a_: