![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.24: Four-helical up-and-down bundle [47161] (28 superfamilies) core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down |
![]() | Superfamily a.24.19: Flagellar export chaperone FliS [101116] (2 families) ![]() can form closed, open and helix-swapped bundles |
![]() | Family a.24.19.1: Flagellar export chaperone FliS [101117] (1 protein) automatically mapped to Pfam PF02561 |
![]() | Protein Flagellar export chaperone FliS [101118] (2 species) |
![]() | Species Aquifex aeolicus [TaxId:63363] [101119] (2 PDB entries) |
![]() | Domain d1orya_: 1ory A: [93466] complexed with a flagelin fragment, chain B complexed with po4 |
PDB Entry: 1ory (more details), 2.45 Å
SCOPe Domain Sequences for d1orya_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1orya_ a.24.19.1 (A:) Flagellar export chaperone FliS {Aquifex aeolicus [TaxId: 63363]} eayfqnqvetatpleqiillydkaiecleraieiydqvnelekrkefvenidrvydiisa lksfldhekgkeiaknldtiytiilntlvkvdktkeelqkileilkdlreaweevkkkv
Timeline for d1orya_: