SCOPe 2.05: Domain d1orub_: 1oru B:

Lineage for d1orub_ (1oru B:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.58: PK beta-barrel domain-like [50799] (1 superfamily)
   barrel, closed; n=7, S=10; complex topology

4. Superfamily b.58.1: PK beta-barrel domain-like [50800] (2 families)

5. Family b.58.1.2: MOSC (MOCO sulphurase C-terminal) domain [101844] (2 proteins)
   Pfam PF03473

6. Protein Hypothetical protein YuaD [101845] (1 species)

7. Species Bacillus subtilis [TaxId:1423] [101846] (1 PDB entry)

8. Domain d1orub_: 1oru B: [93465]
   structural genomics
   complexed with cl, so4

Details for d1orub_

PDB Entry: 1oru, 1.8 Å

PDB Description: Crystal Structure of APC1665, YUAD protein from Bacillus subtilis

PDB Compounds: (B:) yuaD protein

SCOPe Domain Sequences for d1orub_:

Sequence; same for both SEQRES and ATOM records:

>d1orub_ b.58.1.2 (B:) Hypothetical protein YuaD {Bacillus subtilis [TaxId: 1423]}
mwkrmtakaeglyiadtksfvtkqmdkldfdyggipgdlhfgltkkagarepmfsrgtei
fnrrqisivsieecneialkmgvprilpewlganvavsgmpdltslkegsriifpsgaal
lcegendpciqpgeviqsyypdqpklasafvrhalgirgivciverpgavytgdeievhs
yq

Timeline for d1orub_:

• d1orub_ first appeared in SCOP 1.67
  
• d1orub_ appears in SCOPe 2.04
  
• d1orub_ appears in SCOPe 2.06
  
• d1orub_ appears in the current release, SCOPe 2.08