Class b: All beta proteins [48724] (176 folds) |
Fold b.58: PK beta-barrel domain-like [50799] (1 superfamily) barrel, closed; n=7, S=10; complex topology |
Superfamily b.58.1: PK beta-barrel domain-like [50800] (2 families) |
Family b.58.1.2: MOSC (MOCO sulphurase C-terminal) domain [101844] (2 proteins) Pfam PF03473 |
Protein Hypothetical protein YuaD [101845] (1 species) |
Species Bacillus subtilis [TaxId:1423] [101846] (1 PDB entry) |
Domain d1orub_: 1oru B: [93465] structural genomics complexed with cl, so4 |
PDB Entry: 1oru (more details), 1.8 Å
SCOPe Domain Sequences for d1orub_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1orub_ b.58.1.2 (B:) Hypothetical protein YuaD {Bacillus subtilis [TaxId: 1423]} mwkrmtakaeglyiadtksfvtkqmdkldfdyggipgdlhfgltkkagarepmfsrgtei fnrrqisivsieecneialkmgvprilpewlganvavsgmpdltslkegsriifpsgaal lcegendpciqpgeviqsyypdqpklasafvrhalgirgivciverpgavytgdeievhs yq
Timeline for d1orub_: