SCOPe 2.06: Domain d1orua_: 1oru A:

Lineage for d1orua_ (1oru A:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.58: PK beta-barrel domain-like [50799] (1 superfamily)
   barrel, closed; n=7, S=10; complex topology

4. Superfamily b.58.1: PK beta-barrel domain-like [50800] (2 families)

5. Family b.58.1.2: MOSC (MOCO sulphurase C-terminal) domain [101844] (2 proteins)
   Pfam PF03473

6. Protein Hypothetical protein YuaD [101845] (1 species)

7. Species Bacillus subtilis [TaxId:1423] [101846] (1 PDB entry)

8. Domain d1orua_: 1oru A: [93464]
   structural genomics
   complexed with cl, so4

Details for d1orua_

PDB Entry: 1oru, 1.8 Å

PDB Description: Crystal Structure of APC1665, YUAD protein from Bacillus subtilis

PDB Compounds: (A:) yuaD protein

SCOPe Domain Sequences for d1orua_:

Sequence; same for both SEQRES and ATOM records:

>d1orua_ b.58.1.2 (A:) Hypothetical protein YuaD {Bacillus subtilis [TaxId: 1423]}
mwkrmtakaeglyiadtksfvtkqmdkldfdyggipgdlhfgltkkagarepmfsrgtei
fnrrqisivsieecneialkmgvprilpewlganvavsgmpdltslkegsriifpsgaal
lcegendpciqpgeviqsyypdqpklasafvrhalgirgivciverpgavytgdeievhs
yq

Timeline for d1orua_:

• d1orua_ first appeared in SCOP 1.67
  
• d1orua_ appears in SCOPe 2.05
  
• d1orua_ appears in SCOPe 2.07
  
• d1orua_ appears in the current release, SCOPe 2.08