Lineage for d1orrb_ (1orr B:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1826588Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 1826589Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 1826923Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (71 proteins)
    also known as short-chain dehydrogenases and SDR family
    parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7
  6. 1827279Protein CDP-tyvelose-2-epimerase [102138] (1 species)
  7. 1827280Species Salmonella typhi [TaxId:90370] [102139] (1 PDB entry)
  8. 1827282Domain d1orrb_: 1orr B: [93461]
    complexed with cdp, nad

Details for d1orrb_

PDB Entry: 1orr (more details), 1.5 Å

PDB Description: Crystal Structure of CDP-Tyvelose 2-Epimerase complexed with NAD and CDP
PDB Compounds: (B:) CDP-tyvelose-2-epimerase

SCOPe Domain Sequences for d1orrb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1orrb_ c.2.1.2 (B:) CDP-tyvelose-2-epimerase {Salmonella typhi [TaxId: 90370]}
akllitggcgflgsnlasfalsqgidlivfdnlsrkgatdnlhwlsslgnfefvhgdirn
kndvtrlitkympdscfhlagqvamttsidnpcmdfeinvggtlnlleavrqynsncnii
ysstnkvygdleqykynetetrytcvdkpngydestqldfhspygcskgaadqymldyar
ifglntvvfrhssmyggrqfatydqgwvgwfcqkaveiknginkpftisgngkqvrdvlh
aedmislyftalanvskirgnafniggtivnslsllelfklledycnidmrftnlpvres
dqrvfvadikkitnaidwspkvsakdgvqkmydwtssi

SCOPe Domain Coordinates for d1orrb_:

Click to download the PDB-style file with coordinates for d1orrb_.
(The format of our PDB-style files is described here.)

Timeline for d1orrb_: