Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) |
Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (73 proteins) also known as short-chain dehydrogenases and SDR family parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7 has additional subdomain(s) that are not in the common domain |
Protein CDP-tyvelose-2-epimerase [102138] (1 species) |
Species Salmonella typhi [TaxId:90370] [102139] (1 PDB entry) |
Domain d1orrb1: 1orr B:3-339 [93461] Other proteins in same PDB: d1orra2, d1orrb2, d1orrc2, d1orrd2 complexed with cdp, nad has additional subdomain(s) that are not in the common domain |
PDB Entry: 1orr (more details), 1.5 Å
SCOPe Domain Sequences for d1orrb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1orrb1 c.2.1.2 (B:3-339) CDP-tyvelose-2-epimerase {Salmonella typhi [TaxId: 90370]} kllitggcgflgsnlasfalsqgidlivfdnlsrkgatdnlhwlsslgnfefvhgdirnk ndvtrlitkympdscfhlagqvamttsidnpcmdfeinvggtlnlleavrqynsncniiy sstnkvygdleqykynetetrytcvdkpngydestqldfhspygcskgaadqymldyari fglntvvfrhssmyggrqfatydqgwvgwfcqkaveiknginkpftisgngkqvrdvlha edmislyftalanvskirgnafniggtivnslsllelfklledycnidmrftnlpvresd qrvfvadikkitnaidwspkvsakdgvqkmydwtssi
Timeline for d1orrb1: