SCOPe 2.07: Domain d1orja1: 1orj A:1002-1124

Lineage for d1orja1 (1orj A:1002-1124)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.24: Four-helical up-and-down bundle [47161] (28 superfamilies)
   core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down

4. Superfamily a.24.19: Flagellar export chaperone FliS [101116] (2 families)
   can form closed, open and helix-swapped bundles

5. Family a.24.19.1: Flagellar export chaperone FliS [101117] (1 protein)
   automatically mapped to Pfam PF02561

6. Protein Flagellar export chaperone FliS [101118] (2 species)

7. Species Aquifex aeolicus [TaxId:63363] [101119] (2 PDB entries)

8. Domain d1orja1: 1orj A:1002-1124 [93456]
   Other proteins in same PDB: d1orja2, d1orjd2

Details for d1orja1

PDB Entry: 1orj, 2.25 Å

PDB Description: flagellar export chaperone

PDB Compounds: (A:) flagellar protein FliS

SCOPe Domain Sequences for d1orja1:

Sequence; same for both SEQRES and ATOM records:

>d1orja1 a.24.19.1 (A:1002-1124) Flagellar export chaperone FliS {Aquifex aeolicus [TaxId: 63363]}
rniaeayfqnmvetatpleqiillydkaiecleraieiydqvnelekrkefvenidrvyd
iisalksfldhekgkeiaknldtiytiilntlvkvdktkeelqkileilkdlreaweevk
kkv

Timeline for d1orja1:

• d1orja1 first appeared in SCOP 1.67, called d1orja_
  
• d1orja1 appears in SCOPe 2.06
  
• d1orja1 appears in the current release, SCOPe 2.08