Lineage for d1orja1 (1orj A:1002-1124)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2312794Fold a.24: Four-helical up-and-down bundle [47161] (28 superfamilies)
    core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down
  4. 2313956Superfamily a.24.19: Flagellar export chaperone FliS [101116] (2 families) (S)
    can form closed, open and helix-swapped bundles
  5. 2313957Family a.24.19.1: Flagellar export chaperone FliS [101117] (1 protein)
    automatically mapped to Pfam PF02561
  6. 2313958Protein Flagellar export chaperone FliS [101118] (2 species)
  7. 2313959Species Aquifex aeolicus [TaxId:63363] [101119] (2 PDB entries)
  8. 2313960Domain d1orja1: 1orj A:1002-1124 [93456]
    Other proteins in same PDB: d1orja2, d1orjd2

Details for d1orja1

PDB Entry: 1orj (more details), 2.25 Å

PDB Description: flagellar export chaperone
PDB Compounds: (A:) flagellar protein FliS

SCOPe Domain Sequences for d1orja1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1orja1 a.24.19.1 (A:1002-1124) Flagellar export chaperone FliS {Aquifex aeolicus [TaxId: 63363]}
rniaeayfqnmvetatpleqiillydkaiecleraieiydqvnelekrkefvenidrvyd
iisalksfldhekgkeiaknldtiytiilntlvkvdktkeelqkileilkdlreaweevk
kkv

SCOPe Domain Coordinates for d1orja1:

Click to download the PDB-style file with coordinates for d1orja1.
(The format of our PDB-style files is described here.)

Timeline for d1orja1: