Lineage for d1orja_ (1orj A:)

  1. Root: SCOP 1.67
  2. 349259Class a: All alpha proteins [46456] (202 folds)
  3. 353428Fold a.24: Four-helical up-and-down bundle [47161] (20 superfamilies)
    core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down
  4. 353804Superfamily a.24.19: Flagellar export chaperone FliS [101116] (1 family) (S)
    can form closed, open and helix-swapped bundles
  5. 353805Family a.24.19.1: Flagellar export chaperone FliS [101117] (1 protein)
  6. 353806Protein Flagellar export chaperone FliS [101118] (2 species)
  7. 353807Species Aquifex aeolicus [TaxId:63363] [101119] (2 PDB entries)
  8. 353808Domain d1orja_: 1orj A: [93456]

Details for d1orja_

PDB Entry: 1orj (more details), 2.25 Å

PDB Description: flagellar export chaperone

SCOP Domain Sequences for d1orja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1orja_ a.24.19.1 (A:) Flagellar export chaperone FliS {Aquifex aeolicus}
rniaeayfqnmvetatpleqiillydkaiecleraieiydqvnelekrkefvenidrvyd
iisalksfldhekgkeiaknldtiytiilntlvkvdktkeelqkileilkdlreaweevk
kkvhhh

SCOP Domain Coordinates for d1orja_:

Click to download the PDB-style file with coordinates for d1orja_.
(The format of our PDB-style files is described here.)

Timeline for d1orja_: