Lineage for d1orgb_ (1org B:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2710066Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 2711837Superfamily a.39.2: Insect pheromone/odorant-binding proteins [47565] (2 families) (S)
    the N-terminal extension, containing a few short helices, forms a flexible lid for the binding cavity
  5. 2711838Family a.39.2.1: Insect pheromone/odorant-binding proteins [47566] (6 proteins)
    automatically mapped to Pfam PF01395
  6. 2711876Protein Pheromone binding protein PBPLma [101188] (1 species)
  7. 2711877Species Madeira cockroach (Leucophaea maderae) [TaxId:36963] [101189] (3 PDB entries)
  8. 2711883Domain d1orgb_: 1org B: [93454]
    complexed with gol

Details for d1orgb_

PDB Entry: 1org (more details), 1.7 Å

PDB Description: The crystal structure of a pheromone binding protein from the cockroach Leucophaea maderae reveals a new mechanism of pheromone binding
PDB Compounds: (B:) pheromone binding protein

SCOPe Domain Sequences for d1orgb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1orgb_ a.39.2.1 (B:) Pheromone binding protein PBPLma {Madeira cockroach (Leucophaea maderae) [TaxId: 36963]}
stqsykdamgplvrecmgsvsateddfktvlnrnplesrtaqcllacaldkvglispega
iytgddlmpvmnrlygfndfktvmkakavndcanqvngaypdrcdliknftdcvrnsy

SCOPe Domain Coordinates for d1orgb_:

Click to download the PDB-style file with coordinates for d1orgb_.
(The format of our PDB-style files is described here.)

Timeline for d1orgb_: