SCOPe 2.08: Domain d1orgb_: 1org B:

Lineage for d1orgb_ (1org B:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.39: EF Hand-like [47472] (4 superfamilies)
   core: 4 helices; array of 2 hairpins, opened

4. Superfamily a.39.2: Insect pheromone/odorant-binding proteins [47565] (2 families)
   the N-terminal extension, containing a few short helices, forms a flexible lid for the binding cavity

5. Family a.39.2.1: Insect pheromone/odorant-binding proteins [47566] (6 proteins)
   automatically mapped to Pfam PF01395

6. Protein Pheromone binding protein PBPLma [101188] (1 species)

7. Species Madeira cockroach (Leucophaea maderae) [TaxId:36963] [101189] (3 PDB entries)

8. Domain d1orgb_: 1org B: [93454]
   complexed with gol

Details for d1orgb_

PDB Entry: 1org, 1.7 Å

PDB Description: The crystal structure of a pheromone binding protein from the cockroach Leucophaea maderae reveals a new mechanism of pheromone binding

PDB Compounds: (B:) pheromone binding protein

SCOPe Domain Sequences for d1orgb_:

Sequence; same for both SEQRES and ATOM records:

>d1orgb_ a.39.2.1 (B:) Pheromone binding protein PBPLma {Madeira cockroach (Leucophaea maderae) [TaxId: 36963]}
stqsykdamgplvrecmgsvsateddfktvlnrnplesrtaqcllacaldkvglispega
iytgddlmpvmnrlygfndfktvmkakavndcanqvngaypdrcdliknftdcvrnsy

Timeline for d1orgb_:

• d1orgb_ first appeared in SCOP 1.67
  
• d1orgb_ appears in SCOPe 2.07