Class a: All alpha proteins [46456] (289 folds) |
Fold a.39: EF Hand-like [47472] (4 superfamilies) core: 4 helices; array of 2 hairpins, opened |
Superfamily a.39.2: Insect pheromone/odorant-binding proteins [47565] (2 families) the N-terminal extension, containing a few short helices, forms a flexible lid for the binding cavity |
Family a.39.2.1: Insect pheromone/odorant-binding proteins [47566] (6 proteins) automatically mapped to Pfam PF01395 |
Protein Pheromone binding protein PBPLma [101188] (1 species) |
Species Madeira cockroach (Leucophaea maderae) [TaxId:36963] [101189] (3 PDB entries) |
Domain d1orga_: 1org A: [93453] complexed with gol |
PDB Entry: 1org (more details), 1.7 Å
SCOPe Domain Sequences for d1orga_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1orga_ a.39.2.1 (A:) Pheromone binding protein PBPLma {Madeira cockroach (Leucophaea maderae) [TaxId: 36963]} stqsykdamgplvrecmgsvsateddfktvlnrnplesrtaqcllacaldkvglispega iytgddlmpvmnrlygfndfktvmkakavndcanqvngaypdrcdliknftdcvrnsy
Timeline for d1orga_: