Lineage for d1orga_ (1org A:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1733371Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 1734834Superfamily a.39.2: Insect pheromone/odorant-binding proteins [47565] (2 families) (S)
    the N-terminal extension, containing a few short helices, forms a flexible lid for the binding cavity
  5. 1734835Family a.39.2.1: Insect pheromone/odorant-binding proteins [47566] (6 proteins)
    automatically mapped to Pfam PF01395
  6. 1734873Protein Pheromone binding protein PBPLma [101188] (1 species)
  7. 1734874Species Madeira cockroach (Leucophaea maderae) [TaxId:36963] [101189] (3 PDB entries)
  8. 1734879Domain d1orga_: 1org A: [93453]
    complexed with gol

Details for d1orga_

PDB Entry: 1org (more details), 1.7 Å

PDB Description: The crystal structure of a pheromone binding protein from the cockroach Leucophaea maderae reveals a new mechanism of pheromone binding
PDB Compounds: (A:) pheromone binding protein

SCOPe Domain Sequences for d1orga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1orga_ a.39.2.1 (A:) Pheromone binding protein PBPLma {Madeira cockroach (Leucophaea maderae) [TaxId: 36963]}
stqsykdamgplvrecmgsvsateddfktvlnrnplesrtaqcllacaldkvglispega
iytgddlmpvmnrlygfndfktvmkakavndcanqvngaypdrcdliknftdcvrnsy

SCOPe Domain Coordinates for d1orga_:

Click to download the PDB-style file with coordinates for d1orga_.
(The format of our PDB-style files is described here.)

Timeline for d1orga_: