SCOPe 2.05: Domain d1or8a_: 1or8 A:

Lineage for d1or8a_ (1or8 A:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest

4. Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (58 families)

5. Family c.66.1.6: Arginine methyltransferase [53351] (4 proteins)
   lacks the last two strands of the common fold replaced with a beta-sandwich oligomerisation subdomain

6. Protein Protein arginine N-methyltransferase 1, PRMT1 [89749] (1 species)

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [89750] (3 PDB entries)

8. Domain d1or8a_: 1or8 A: [93451]
   complexed with substrate peptide, chains B,C, D and E
   complexed with gol, sah, unl

Details for d1or8a_

PDB Entry: 1or8, 2.35 Å

PDB Description: Structure of the Predominant protein arginine methyltransferase PRMT1

PDB Compounds: (A:) Protein arginine N-methyltransferase 1

SCOPe Domain Sequences for d1or8a_:

Sequence; same for both SEQRES and ATOM records:

>d1or8a_ c.66.1.6 (A:) Protein arginine N-methyltransferase 1, PRMT1 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
hfgiheemlkdevrtltyrnsmfhnrhlfkdkvvldvgsgtgilcmfaakagarkvigie
cssisdyavkivkankldhvvtiikgkveevelpvekvdiiisewmgyclfyesmlntvl
hardkwlapdglifpdratlyvtaiedrqykdykihwwenvygfdmscikdvaikeplvd
vvdpkqlvtnaclikevdiytvkvedltftspfclqvkrndyvhalvayfnieftrchkr
tgfstspespythwkqtvfymedyltvktgeeifgtigmrpnaknnrdldftidldfkgq
lcelscstdyrmr

Timeline for d1or8a_:

• d1or8a_ first appeared in SCOP 1.67
  
• d1or8a_ appears in SCOPe 2.04
  
• d1or8a_ appears in SCOPe 2.06
  
• d1or8a_ appears in the current release, SCOPe 2.08