Lineage for d1or6b_ (1or6 B:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1976410Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 1976411Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 1976495Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 1976661Protein Heme-based aerotactic transducer HemAT, sensor domain [100980] (1 species)
  7. 1976662Species Bacillus subtilis [TaxId:1423] [100981] (2 PDB entries)
  8. 1976666Domain d1or6b_: 1or6 B: [93450]
    complexed with hem

Details for d1or6b_

PDB Entry: 1or6 (more details), 2.71 Å

PDB Description: Crystal Structure of HemAT sensor domain from B.subtilis in the unliganded form
PDB Compounds: (B:) Heme-based aerotactic transducer hemAT

SCOPe Domain Sequences for d1or6b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1or6b_ a.1.1.2 (B:) Heme-based aerotactic transducer HemAT, sensor domain {Bacillus subtilis [TaxId: 1423]}
nriqltnkhadvkkqlkmvrlgdaelyvleqlqpliqenivnivdafyknldhesslmdi
indhssvdrlkqtlkrhiqemfagviddefiekrnriasihlrigllpkwymgafqelll
smidiyeasitnqqellkaikattkilnleqqlvle

SCOPe Domain Coordinates for d1or6b_:

Click to download the PDB-style file with coordinates for d1or6b_.
(The format of our PDB-style files is described here.)

Timeline for d1or6b_: