Lineage for d1or6a_ (1or6 A:)

  1. Root: SCOP 1.69
  2. 436025Class a: All alpha proteins [46456] (218 folds)
  3. 436026Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 436027Superfamily a.1.1: Globin-like [46458] (4 families) (S)
  5. 436063Family a.1.1.2: Globins [46463] (22 proteins)
    Heme-binding protein
  6. 436128Protein Heme-based aerotactic transducer HemAT, sensor domain [100980] (1 species)
  7. 436129Species Bacillus subtilis [TaxId:1423] [100981] (2 PDB entries)
  8. 436132Domain d1or6a_: 1or6 A: [93449]

Details for d1or6a_

PDB Entry: 1or6 (more details), 2.71 Å

PDB Description: Crystal Structure of HemAT sensor domain from B.subtilis in the unliganded form

SCOP Domain Sequences for d1or6a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1or6a_ a.1.1.2 (A:) Heme-based aerotactic transducer HemAT, sensor domain {Bacillus subtilis}
tayfsdsngqqknriqltnkhadvkkqlkmvrlgdaelyvleqlqpliqenivnivdafy
knldhesslmdiindhssvdrlkqtlkrhiqemfagviddefiekrnriasihlrigllp
kwymgafqelllsmidiyeasitnqqellkaikattkilnleqqlvle

SCOP Domain Coordinates for d1or6a_:

Click to download the PDB-style file with coordinates for d1or6a_.
(The format of our PDB-style files is described here.)

Timeline for d1or6a_: