Lineage for d1or4b_ (1or4 B:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2685878Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 2685879Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 2685963Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 2686131Protein Heme-based aerotactic transducer HemAT, sensor domain [100980] (1 species)
  7. 2686132Species Bacillus subtilis [TaxId:1423] [100981] (2 PDB entries)
  8. 2686134Domain d1or4b_: 1or4 B: [93448]
    complexed with cyn, hem

Details for d1or4b_

PDB Entry: 1or4 (more details), 2.15 Å

PDB Description: Crystal Structure of HemAT sensor domain from B.subtilis in the cyano-liganded form
PDB Compounds: (B:) Heme-based aerotactic transducer hemAT

SCOPe Domain Sequences for d1or4b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1or4b_ a.1.1.2 (B:) Heme-based aerotactic transducer HemAT, sensor domain {Bacillus subtilis [TaxId: 1423]}
qknriqltnkhadvkkqlkmvrlgdaelyvleqlqpliqenivnivdafyknldhesslm
diindhssvdrlkqtlkrhiqemfagviddefiekrnriasihlrigllpkwymgafqel
llsmidiyeasitnqqellkaikattkilnleqqlvle

SCOPe Domain Coordinates for d1or4b_:

Click to download the PDB-style file with coordinates for d1or4b_.
(The format of our PDB-style files is described here.)

Timeline for d1or4b_: