Lineage for d1or4a_ (1or4 A:)

  1. Root: SCOP 1.67
  2. 349259Class a: All alpha proteins [46456] (202 folds)
  3. 349260Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 349261Superfamily a.1.1: Globin-like [46458] (4 families) (S)
  5. 349289Family a.1.1.2: Globins [46463] (20 proteins)
    Heme-binding protein
  6. 349345Protein Heme-based aerotactic transducer HemAT, sensor domain [100980] (1 species)
  7. 349346Species Bacillus subtilis [TaxId:1423] [100981] (2 PDB entries)
  8. 349347Domain d1or4a_: 1or4 A: [93447]

Details for d1or4a_

PDB Entry: 1or4 (more details), 2.15 Å

PDB Description: Crystal Structure of HemAT sensor domain from B.subtilis in the cyano-liganded form

SCOP Domain Sequences for d1or4a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1or4a_ a.1.1.2 (A:) Heme-based aerotactic transducer HemAT, sensor domain {Bacillus subtilis}
etayfsdsngqqknriqltnkhadvkkqlkmvrlgdaelyvleqlqpliqenivnivdaf
yknldhesslmdiindhssvdrlkqtlkrhiqemfagviddefiekrnriasihlrigll
pkwymgafqelllsmidiyeasitnqqellkaikattkilnleqqlvle

SCOP Domain Coordinates for d1or4a_:

Click to download the PDB-style file with coordinates for d1or4a_.
(The format of our PDB-style files is described here.)

Timeline for d1or4a_: