| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
Superfamily a.1.1: Globin-like [46458] (5 families) ![]() |
| Family a.1.1.2: Globins [46463] (27 proteins) Heme-binding protein |
| Protein Heme-based aerotactic transducer HemAT, sensor domain [100980] (1 species) |
| Species Bacillus subtilis [TaxId:1423] [100981] (2 PDB entries) |
| Domain d1or4a_: 1or4 A: [93447] complexed with cyn, hem |
PDB Entry: 1or4 (more details), 2.15 Å
SCOPe Domain Sequences for d1or4a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1or4a_ a.1.1.2 (A:) Heme-based aerotactic transducer HemAT, sensor domain {Bacillus subtilis [TaxId: 1423]}
etayfsdsngqqknriqltnkhadvkkqlkmvrlgdaelyvleqlqpliqenivnivdaf
yknldhesslmdiindhssvdrlkqtlkrhiqemfagviddefiekrnriasihlrigll
pkwymgafqelllsmidiyeasitnqqellkaikattkilnleqqlvle
Timeline for d1or4a_: