Lineage for d1oqya4 (1oqy A:1-77)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1892544Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 1892545Superfamily d.15.1: Ubiquitin-like [54236] (9 families) (S)
  5. 1892546Family d.15.1.1: Ubiquitin-related [54237] (39 proteins)
    Pfam PF00240
  6. 1893199Protein Ubiquitin-like domain of Rad23 homolog A (Hhr23a) [102775] (1 species)
  7. 1893200Species Human (Homo sapiens) [TaxId:9606] [102776] (4 PDB entries)
  8. 1893204Domain d1oqya4: 1oqy A:1-77 [93442]
    Other proteins in same PDB: d1oqya1, d1oqya2, d1oqya3
    flexible linkers excluded

Details for d1oqya4

PDB Entry: 1oqy (more details)

PDB Description: structure of the dna repair protein hhr23a
PDB Compounds: (A:) uv excision repair protein rad23 homolog a

SCOPe Domain Sequences for d1oqya4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1oqya4 d.15.1.1 (A:1-77) Ubiquitin-like domain of Rad23 homolog A (Hhr23a) {Human (Homo sapiens) [TaxId: 9606]}
savtitlktlqqqtfkirmepdetvkvlkekieaekgrdafpvagqkliyagkilsddvp
irdyrideknfvvvmvt

SCOPe Domain Coordinates for d1oqya4:

Click to download the PDB-style file with coordinates for d1oqya4.
(The format of our PDB-style files is described here.)

Timeline for d1oqya4: