SCOP 1.71: Domain d1oqya4: 1oqy A:1-77

Lineage for d1oqya4 (1oqy A:1-77)

1. Root: SCOP 1.71

2. Class d: Alpha and beta proteins (a+b) [53931] (286 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (12 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.1: Ubiquitin-like [54236] (6 families)

5. Family d.15.1.1: Ubiquitin-related [54237] (26 proteins)
   Pfam 00240

6. Protein Ubiquitin-like domain of Rad23 homolog A (Hhr23a) [102775] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [102776] (4 PDB entries)

8. Domain d1oqya4: 1oqy A:1-77 [93442]
   Other proteins in same PDB: d1oqya1, d1oqya2, d1oqya3
   flexible linkers excluded

Details for d1oqya4

PDB Entry: 1oqy

PDB Description: structure of the dna repair protein hhr23a

SCOP Domain Sequences for d1oqya4:

Sequence; same for both SEQRES and ATOM records:

>d1oqya4 d.15.1.1 (A:1-77) Ubiquitin-like domain of Rad23 homolog A (Hhr23a) {Human (Homo sapiens)}
savtitlktlqqqtfkirmepdetvkvlkekieaekgrdafpvagqkliyagkilsddvp
irdyrideknfvvvmvt

Timeline for d1oqya4:

• d1oqya4 first appeared in SCOP 1.67
  
• d1oqya4 appears in SCOP 1.69
  
• d1oqya4 appears in SCOP 1.73
  
• d1oqya4 appears in the current release, SCOPe 2.08