SCOP 1.75: Domain d1oqya3: 1oqy A:232-283

Lineage for d1oqya3 (1oqy A:232-283)

1. Root: SCOP 1.75

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.189: XPC-binding domain [101237] (1 superfamily)
   4 helices; array

4. Superfamily a.189.1: XPC-binding domain [101238] (1 family)

5. Family a.189.1.1: XPC-binding domain [101239] (3 proteins)

6. Protein XPC-binding domain of Rad23 homolog A (Hhr23a) [101240] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [101241] (3 PDB entries)
   Uniprot P54725 230-288

8. Domain d1oqya3: 1oqy A:232-283 [93441]
   Other proteins in same PDB: d1oqya1, d1oqya2, d1oqya4
   flexible linkers excluded

Details for d1oqya3

PDB Entry: 1oqy

PDB Description: structure of the dna repair protein hhr23a

PDB Compounds: (A:) uv excision repair protein rad23 homolog a

SCOP Domain Sequences for d1oqya3:

Sequence; same for both SEQRES and ATOM records:

>d1oqya3 a.189.1.1 (A:232-283) XPC-binding domain of Rad23 homolog A (Hhr23a) {Human (Homo sapiens) [TaxId: 9606]}
leflrdqpqfqnmrqviqqnpallpallqqlgqenpqllqqisrhqeqfiqm

Timeline for d1oqya3:

• d1oqya3 first appeared in SCOP 1.67
  
• d1oqya3 appears in SCOP 1.73
  
• d1oqya3 appears in SCOPe 2.01
  
• d1oqya3 appears in the current release, SCOPe 2.08