Lineage for d1oqya2 (1oqy A:317-360)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 534233Fold a.5: RuvA C-terminal domain-like [46928] (9 superfamilies)
    3 helices; bundle, right-handed twist
  4. 534257Superfamily a.5.2: UBA-like [46934] (4 families) (S)
  5. 534258Family a.5.2.1: UBA domain [46935] (11 proteins)
  6. 534262Protein DNA repair protein Hhr23a [46936] (1 species)
  7. 534263Species Human (Homo sapiens) [TaxId:9606] [46937] (5 PDB entries)
  8. 534267Domain d1oqya2: 1oqy A:317-360 [93440]
    Other proteins in same PDB: d1oqya3, d1oqya4
    flexible linkers excluded

Details for d1oqya2

PDB Entry: 1oqy (more details)

PDB Description: structure of the dna repair protein hhr23a

SCOP Domain Sequences for d1oqya2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1oqya2 a.5.2.1 (A:317-360) DNA repair protein Hhr23a {Human (Homo sapiens)}
tpqekeaierlkalgfpeslviqayfaceknenlaanfllsqnf

SCOP Domain Coordinates for d1oqya2:

Click to download the PDB-style file with coordinates for d1oqya2.
(The format of our PDB-style files is described here.)

Timeline for d1oqya2: