Class a: All alpha proteins [46456] (289 folds) |
Fold a.25: Ferritin-like [47239] (6 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
Superfamily a.25.1: Ferritin-like [47240] (10 families) contains bimetal-ion centre in the middle of the bundle |
Family a.25.1.2: Ribonucleotide reductase-like [47253] (9 proteins) |
Protein Ribonucleotide reductase R2 [47257] (10 species) |
Species Corynebacterium ammoniagenes [TaxId:1697] [69006] (6 PDB entries) |
Domain d1oqud_: 1oqu D: [93438] complexed with act, fe, oxy |
PDB Entry: 1oqu (more details), 2 Å
SCOPe Domain Sequences for d1oqud_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1oqud_ a.25.1.2 (D:) Ribonucleotide reductase R2 {Corynebacterium ammoniagenes [TaxId: 1697]} sneydeyianhtdpvkainwnvipdekdlevwdrltgnfwlpekipvsndiqswnkmtpq eqlatmrvftgltlldtiqgtvgaisllpdaetmheeavytniafmesvhaksysnifmt lastpqineafrwseenenlqrkakiimsyyngddplkkkvastllesflfysgfylpmy lssrakltntadiirliirdesvhgyyigykyqqgvkklseaeqeeykaytfdlmydlye neieytediyddlgwtedvkrflrynankalnnlgyeglfptdetkvspailssls
Timeline for d1oqud_: