SCOPe 2.06: Domain d1oqud_: 1oqu D:

Lineage for d1oqud_ (1oqu D:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.25: Ferritin-like [47239] (6 superfamilies)
   core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection

4. Superfamily a.25.1: Ferritin-like [47240] (10 families)
   contains bimetal-ion centre in the middle of the bundle

5. Family a.25.1.2: Ribonucleotide reductase-like [47253] (9 proteins)

6. Protein Ribonucleotide reductase R2 [47257] (10 species)

7. Species Corynebacterium ammoniagenes [TaxId:1697] [69006] (6 PDB entries)

8. Domain d1oqud_: 1oqu D: [93438]
   complexed with act, fe, oxy

Details for d1oqud_

PDB Entry: 1oqu, 2 Å

PDB Description: a protein coordinated tri-nuclear fe complex formed during soaking of crystals of the ribonucleotide reductase r2f protein from corynebacterium ammoniagenes

PDB Compounds: (D:) Ribonucleotide reductase subunit R2F

SCOPe Domain Sequences for d1oqud_:

Sequence; same for both SEQRES and ATOM records:

>d1oqud_ a.25.1.2 (D:) Ribonucleotide reductase R2 {Corynebacterium ammoniagenes [TaxId: 1697]}
sneydeyianhtdpvkainwnvipdekdlevwdrltgnfwlpekipvsndiqswnkmtpq
eqlatmrvftgltlldtiqgtvgaisllpdaetmheeavytniafmesvhaksysnifmt
lastpqineafrwseenenlqrkakiimsyyngddplkkkvastllesflfysgfylpmy
lssrakltntadiirliirdesvhgyyigykyqqgvkklseaeqeeykaytfdlmydlye
neieytediyddlgwtedvkrflrynankalnnlgyeglfptdetkvspailssls

Timeline for d1oqud_:

• d1oqud_ first appeared in SCOP 1.67
  
• d1oqud_ appears in SCOPe 2.05
  
• d1oqud_ appears in SCOPe 2.07
  
• d1oqud_ appears in the current release, SCOPe 2.08