Lineage for d1oquc_ (1oqu C:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1988413Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 1988414Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 1990025Family a.25.1.2: Ribonucleotide reductase-like [47253] (9 protein domains)
  6. 1990178Protein Ribonucleotide reductase R2 [47257] (10 species)
  7. 1990191Species Corynebacterium ammoniagenes [TaxId:1697] [69006] (6 PDB entries)
  8. 1990206Domain d1oquc_: 1oqu C: [93437]
    complexed with act, fe, oxy

Details for d1oquc_

PDB Entry: 1oqu (more details), 2 Å

PDB Description: a protein coordinated tri-nuclear fe complex formed during soaking of crystals of the ribonucleotide reductase r2f protein from corynebacterium ammoniagenes
PDB Compounds: (C:) Ribonucleotide reductase subunit R2F

SCOPe Domain Sequences for d1oquc_:

Sequence, based on SEQRES records: (download)

>d1oquc_ a.25.1.2 (C:) Ribonucleotide reductase R2 {Corynebacterium ammoniagenes [TaxId: 1697]}
sneydeyianhtdpvkainwnvipdekdlevwdrltgnfwlpekipvsndiqswnkmtpq
eqlatmrvftgltlldtiqgtvgaisllpdaetmheeavytniafmesvhaksysnifmt
lastpqineafrwseenenlqrkakiimsyyngddplkkkvastllesflfysgfylpmy
lssrakltntadiirliirdesvhgyyigykyqqgvkklseaeqeeykaytfdlmydlye
neieytediyddlgwtedvkrflrynankalnnlgyeglfptdetkvspailsslspnad
enhdffsgsgssyvigkaedttdddwdf

Sequence, based on observed residues (ATOM records): (download)

>d1oquc_ a.25.1.2 (C:) Ribonucleotide reductase R2 {Corynebacterium ammoniagenes [TaxId: 1697]}
sneydeyianhtdpvkainwnvipdekdlevwdrltgnfwlpekipvsndiqswnkmtpq
eqlatmrvftgltlldtiqgtvgaisllpdaetmheeavytniafmesvhaksysnifmt
lastpqineafrwseenenlqrkakiimsyyngddplkkkvastllesflfysgfylpmy
lssrakltntadiirliirdesvhgyyigykyqqgvkklseaeqeeykaytfdlmydlye
neieytediyddlgwtedvkrflrynankalnnlgyeglfptdetkvspailsslsdddw
df

SCOPe Domain Coordinates for d1oquc_:

Click to download the PDB-style file with coordinates for d1oquc_.
(The format of our PDB-style files is described here.)

Timeline for d1oquc_: