Lineage for d1oqub_ (1oqu B:)

  1. Root: SCOP 1.69
  2. 436025Class a: All alpha proteins [46456] (218 folds)
  3. 441060Fold a.25: Ferritin-like [47239] (2 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 441061Superfamily a.25.1: Ferritin-like [47240] (3 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 441421Family a.25.1.2: Ribonucleotide reductase-like [47253] (7 proteins)
  6. 441523Protein Ribonucleotide reductase R2 [47257] (8 species)
  7. 441536Species Corynebacterium ammoniagenes [TaxId:1697] [69006] (4 PDB entries)
  8. 441546Domain d1oqub_: 1oqu B: [93436]

Details for d1oqub_

PDB Entry: 1oqu (more details), 2 Å

PDB Description: a protein coordinated tri-nuclear fe complex formed during soaking of crystals of the ribonucleotide reductase r2f protein from corynebacterium ammoniagenes

SCOP Domain Sequences for d1oqub_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1oqub_ a.25.1.2 (B:) Ribonucleotide reductase R2 {Corynebacterium ammoniagenes}
sneydeyianhtdpvkainwnvipdekdlevwdrltgnfwlpekipvsndiqswnkmtpq
eqlatmrvftgltlldtiqgtvgaisllpdaetmheeavytniafmesvhaksysnifmt
lastpqineafrwseenenlqrkakiimsyyngddplkkkvastllesflfysgfylpmy
lssrakltntadiirliirdesvhgyyigykyqqgvkklseaeqeeykaytfdlmydlye
neieytediyddlgwtedvkrflrynankalnnlgyeglfptdetkvspailssls

SCOP Domain Coordinates for d1oqub_:

Click to download the PDB-style file with coordinates for d1oqub_.
(The format of our PDB-style files is described here.)

Timeline for d1oqub_: