Lineage for d1oqua_ (1oqu A:)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 766018Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 766019Superfamily a.25.1: Ferritin-like [47240] (9 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 766648Family a.25.1.2: Ribonucleotide reductase-like [47253] (8 proteins)
  6. 766797Protein Ribonucleotide reductase R2 [47257] (9 species)
  7. 766810Species Corynebacterium ammoniagenes [TaxId:1697] [69006] (5 PDB entries)
  8. 766821Domain d1oqua_: 1oqu A: [93435]

Details for d1oqua_

PDB Entry: 1oqu (more details), 2 Å

PDB Description: a protein coordinated tri-nuclear fe complex formed during soaking of crystals of the ribonucleotide reductase r2f protein from corynebacterium ammoniagenes
PDB Compounds: (A:) Ribonucleotide reductase subunit R2F

SCOP Domain Sequences for d1oqua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1oqua_ a.25.1.2 (A:) Ribonucleotide reductase R2 {Corynebacterium ammoniagenes [TaxId: 1697]}
sneydeyianhtdpvkainwnvipdekdlevwdrltgnfwlpekipvsndiqswnkmtpq
eqlatmrvftgltlldtiqgtvgaisllpdaetmheeavytniafmesvhaksysnifmt
lastpqineafrwseenenlqrkakiimsyyngddplkkkvastllesflfysgfylpmy
lssrakltntadiirliirdesvhgyyigykyqqgvkklseaeqeeykaytfdlmydlye
neieytediyddlgwtedvkrflrynankalnnlgyeglfptdetkvspailssls

SCOP Domain Coordinates for d1oqua_:

Click to download the PDB-style file with coordinates for d1oqua_.
(The format of our PDB-style files is described here.)

Timeline for d1oqua_: