![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily) common core: 2 helices, disulfide-linked, and a calcium-binding loop |
![]() | Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (4 families) ![]() |
![]() | Family a.133.1.2: Vertebrate phospholipase A2 [48623] (3 proteins) automatically mapped to Pfam PF00068 |
![]() | Protein Snake phospholipase A2 [48624] (38 species) |
![]() | Species Siamese russell's viper (Daboia russelli siamensis), RV7 inhibitory subunit [TaxId:343250] [101484] (1 PDB entry) |
![]() | Domain d1oqsg_: 1oqs G: [93433] complex with catalytic subunit |
PDB Entry: 1oqs (more details), 1.9 Å
SCOPe Domain Sequences for d1oqsg_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1oqsg_ a.133.1.2 (G:) Snake phospholipase A2 {Siamese russell's viper (Daboia russelli siamensis), RV7 inhibitory subunit [TaxId: 343250]} nlfqfgemilqktgkevvhsyaiygcycgwggqgraqdatdrccfvhdccygtvndcnpk tatysysfengdivcgdndlclrtvcecdraaaiclgqnvntydknyeyysishcteese qc
Timeline for d1oqsg_: