Lineage for d1oqsg_ (1oqs G:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2732915Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily)
    common core: 2 helices, disulfide-linked, and a calcium-binding loop
  4. 2732916Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (4 families) (S)
  5. 2732921Family a.133.1.2: Vertebrate phospholipase A2 [48623] (3 proteins)
    automatically mapped to Pfam PF00068
  6. 2733039Protein Snake phospholipase A2 [48624] (38 species)
  7. 2733225Species Siamese russell's viper (Daboia russelli siamensis), RV7 inhibitory subunit [TaxId:343250] [101484] (1 PDB entry)
  8. 2733229Domain d1oqsg_: 1oqs G: [93433]
    complex with catalytic subunit

Details for d1oqsg_

PDB Entry: 1oqs (more details), 1.9 Å

PDB Description: Crystal Structure of RV4/RV7 Complex
PDB Compounds: (G:) Phospholipase A2 RV-7

SCOPe Domain Sequences for d1oqsg_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1oqsg_ a.133.1.2 (G:) Snake phospholipase A2 {Siamese russell's viper (Daboia russelli siamensis), RV7 inhibitory subunit [TaxId: 343250]}
nlfqfgemilqktgkevvhsyaiygcycgwggqgraqdatdrccfvhdccygtvndcnpk
tatysysfengdivcgdndlclrtvcecdraaaiclgqnvntydknyeyysishcteese
qc

SCOPe Domain Coordinates for d1oqsg_:

Click to download the PDB-style file with coordinates for d1oqsg_.
(The format of our PDB-style files is described here.)

Timeline for d1oqsg_: