Lineage for d1oqsf_ (1oqs F:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2345955Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily)
    common core: 2 helices, disulfide-linked, and a calcium-binding loop
  4. 2345956Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (4 families) (S)
  5. 2345961Family a.133.1.2: Vertebrate phospholipase A2 [48623] (3 proteins)
    automatically mapped to Pfam PF00068
  6. 2346077Protein Snake phospholipase A2 [48624] (38 species)
  7. 2346258Species Siamese russell's viper (Daboia russelli siamensis), RV4 catalytic subunit [TaxId:343250] [101485] (1 PDB entry)
  8. 2346261Domain d1oqsf_: 1oqs F: [93432]
    complex with inhibitory subunit

Details for d1oqsf_

PDB Entry: 1oqs (more details), 1.9 Å

PDB Description: Crystal Structure of RV4/RV7 Complex
PDB Compounds: (F:) Phospholipase A2 RV-4

SCOPe Domain Sequences for d1oqsf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1oqsf_ a.133.1.2 (F:) Snake phospholipase A2 {Siamese russell's viper (Daboia russelli siamensis), RV4 catalytic subunit [TaxId: 343250]}
nlfqfarmingklgafsvwnyisygcycgwggqgtpkdatdrccfvhdccyggvkgcnpk
laiysysfqrgnivcgrnngclrticecdrvaancfhqnkntynkeykflssskcrqrse
qc

SCOPe Domain Coordinates for d1oqsf_:

Click to download the PDB-style file with coordinates for d1oqsf_.
(The format of our PDB-style files is described here.)

Timeline for d1oqsf_: