Lineage for d1oqse_ (1oqs E:)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 544466Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily)
    common core: 2 helices, disulfide-linked, and a calcium-binding loop
  4. 544467Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (3 families) (S)
  5. 544472Family a.133.1.2: Vertebrate phospholipase A2 [48623] (2 proteins)
  6. 544553Protein Snake phospholipase A2 [48624] (35 species)
  7. 544685Species Siamese russell's viper (Daboia russelli siamensis), RV7 inhibitory subunit [TaxId:343250] [101484] (1 PDB entry)
  8. 544688Domain d1oqse_: 1oqs E: [93431]

Details for d1oqse_

PDB Entry: 1oqs (more details), 1.9 Å

PDB Description: Crystal Structure of RV4/RV7 Complex

SCOP Domain Sequences for d1oqse_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1oqse_ a.133.1.2 (E:) Snake phospholipase A2 {Siamese russell's viper (Daboia russelli siamensis), RV7 inhibitory subunit}
nlfqfgemilqktgkevvhsyaiygcycgwggqgraqdatdrccfvhdccygtvndcnpk
tatysysfengdivcgdndlclrtvcecdraaaiclgqnvntydknyeyysishcteese
qc

SCOP Domain Coordinates for d1oqse_:

Click to download the PDB-style file with coordinates for d1oqse_.
(The format of our PDB-style files is described here.)

Timeline for d1oqse_: