Lineage for d1oqsb_ (1oqs B:)

  1. Root: SCOP 1.69
  2. 436025Class a: All alpha proteins [46456] (218 folds)
  3. 449032Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily)
    common core: 2 helices, disulfide-linked, and a calcium-binding loop
  4. 449033Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (3 families) (S)
  5. 449038Family a.133.1.2: Vertebrate phospholipase A2 [48623] (2 proteins)
  6. 449118Protein Snake phospholipase A2 [48624] (35 species)
  7. 449243Species Siamese russell's viper (Daboia russelli siamensis), RV4 catalytic subunit [TaxId:343250] [101485] (1 PDB entry)
  8. 449244Domain d1oqsb_: 1oqs B: [93428]

Details for d1oqsb_

PDB Entry: 1oqs (more details), 1.9 Å

PDB Description: Crystal Structure of RV4/RV7 Complex

SCOP Domain Sequences for d1oqsb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1oqsb_ a.133.1.2 (B:) Snake phospholipase A2 {Siamese russell's viper (Daboia russelli siamensis), RV4 catalytic subunit}
nlfqfarmingklgafsvwnyisygcycgwggqgtpkdatdrccfvhdccyggvkgcnpk
laiysysfqrgnivcgrnngclrticecdrvaancfhqnkntynkeykflssskcrqrse
qc

SCOP Domain Coordinates for d1oqsb_:

Click to download the PDB-style file with coordinates for d1oqsb_.
(The format of our PDB-style files is described here.)

Timeline for d1oqsb_: