Lineage for d1oqsa_ (1oqs A:)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 777954Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily)
    common core: 2 helices, disulfide-linked, and a calcium-binding loop
  4. 777955Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (3 families) (S)
  5. 777960Family a.133.1.2: Vertebrate phospholipase A2 [48623] (2 proteins)
  6. 778048Protein Snake phospholipase A2 [48624] (35 species)
  7. 778162Species Siamese russell's viper (Daboia russelli siamensis), RV7 inhibitory subunit [TaxId:343250] [101484] (1 PDB entry)
  8. 778163Domain d1oqsa_: 1oqs A: [93427]
    complex with catalytic subunit

Details for d1oqsa_

PDB Entry: 1oqs (more details), 1.9 Å

PDB Description: Crystal Structure of RV4/RV7 Complex
PDB Compounds: (A:) Phospholipase A2 RV-7

SCOP Domain Sequences for d1oqsa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1oqsa_ a.133.1.2 (A:) Snake phospholipase A2 {Siamese russell's viper (Daboia russelli siamensis), RV7 inhibitory subunit [TaxId: 343250]}
nlfqfgemilqktgkevvhsyaiygcycgwggqgraqdatdrccfvhdccygtvndcnpk
tatysysfengdivcgdndlclrtvcecdraaaiclgqnvntydknyeyysishcteese
qc

SCOP Domain Coordinates for d1oqsa_:

Click to download the PDB-style file with coordinates for d1oqsa_.
(The format of our PDB-style files is described here.)

Timeline for d1oqsa_: