Lineage for d1oqnb_ (1oqn B:)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1132154Fold b.55: PH domain-like barrel [50728] (2 superfamilies)
    barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix
  4. 1132155Superfamily b.55.1: PH domain-like [50729] (14 families) (S)
  5. 1132412Family b.55.1.2: Phosphotyrosine-binding domain (PTB) [50755] (13 proteins)
    Pfam PF00640
  6. 1132417Protein Disabled homolog 1 (Dab1) [89357] (1 species)
  7. 1132418Species Mouse (Mus musculus) [TaxId:10090] [89358] (3 PDB entries)
  8. 1132422Domain d1oqnb_: 1oqn B: [93421]
    complexed with peptide and I3P
    complexed with i3p

Details for d1oqnb_

PDB Entry: 1oqn (more details), 2.3 Å

PDB Description: Crystal structure of the phosphotyrosine binding domain (PTB) of mouse Disabled 1 (Dab1)
PDB Compounds: (B:) Disabled homolog 1

SCOPe Domain Sequences for d1oqnb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1oqnb_ b.55.1.2 (B:) Disabled homolog 1 (Dab1) {Mouse (Mus musculus) [TaxId: 10090]}
drseatlikrfkgegvrykakligidevsaargdklcqdsmmklkgvvagarskgehkqk
ifltisfggikifdektgalqhhhavheisyiakditdhrafgyvcgkegnhrfvaikta
qaaepvildlrdlfqliyelkqreelekkaq

SCOPe Domain Coordinates for d1oqnb_:

Click to download the PDB-style file with coordinates for d1oqnb_.
(The format of our PDB-style files is described here.)

Timeline for d1oqnb_: